RetrogeneDB ID: | retro_tbel_3277 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_135796:52791..52998(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SFT2D1 | ||
| Ensembl ID: | ENSTBEG00000000045 | ||
| Aliases: | None | ||
| Description: | SFT2 domain containing 1 [Source:HGNC Symbol;Acc:21102] |
| Percent Identity: | 60.0 % |
| Parental protein coverage: | 86.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | TCFLMGPVKQLKKMFETTRLLATIIMLLCFVCTLCAALWWHKKGLXXXXXXXXXXXXXXYSLSYIPYARD |
| TC.LMGP.KQLKKMFET..LLAT.IM.L.FVCTLCA..WW.KK.L..............YSLSY..YAR. | |
| Retrocopy | TC-LMGPMKQLKKMFETMTLLATTIMVLFFVCTLCATVWWDKKSLALLVCILQFLLMTWYSLSYVLYARE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009311 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000002993 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000000811 | 2 retrocopies | |
| Equus caballus | ENSECAG00000019479 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000073468 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000001200 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006302 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000003408 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000017165 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000012673 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000004020 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000045 | 2 retrocopies |
retro_tbel_3277 , retro_tbel_747,
|
| Tursiops truncatus | ENSTTRG00000004447 | 2 retrocopies |