RetrogeneDB ID: | retro_tbel_3099 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_130237:5319..5509(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | KIAA0101 | ||
| Ensembl ID: | ENSTBEG00000013732 | ||
| Aliases: | None | ||
| Description: | KIAA0101 [Source:HGNC Symbol;Acc:28961] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 63.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MVRTKADSVPGAYRKVVASRAPRKVLGS-STSATNSKSPSSRKAENKYAGGNPVCVRPTPKWQK |
| MV.TKAD.V...YRK.VASRAPRKVLGS..T.ATNSK.P.SRK.ENKY.GGNPVCV.PT.K.QK | |
| Retrocopy | MVQTKADNVSVTYRKMVASRAPRKVLGS>ATFATNSKPPFSRKTENKYTGGNPVCVCPTTKRQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000010763 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000006482 | 3 retrocopies | |
| Dipodomys ordii | ENSDORG00000014912 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000027710 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000040204 | 7 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003982 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000016561 | 5 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000019643 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013732 | 2 retrocopies |
retro_tbel_3099 , retro_tbel_4093,
|