RetrogeneDB ID: | retro_ogar_501 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873522.1:3238454..3238659(-) | ||
| Located in intron of: | ENSOGAG00000004243 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | KIAA0101 | ||
| Ensembl ID: | ENSOGAG00000003982 | ||
| Aliases: | None | ||
| Description: | KIAA0101 [Source:HGNC Symbol;Acc:28961] |
| Percent Identity: | 68.12 % |
| Parental protein coverage: | 61.26 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | TKADSVPGTYRKVVASRAPRKVLGSSTSATNSASPSSRKAENKYT-GGNPVCVRPTPKWQKGIGEFFRL |
| TKAD..PGTYR.VVAS.AP.K.L.SS..ATNS.S.S.RKAENKY...GNP.C..PTP.WQKGI.EF.R. | |
| Retrocopy | TKADNIPGTYRNVVAS*APGKGLCSSIFATNSGSFSLRKAENKYA>RGNPICDSPTPMWQKGIREFLRI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000010763 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000006482 | 3 retrocopies | |
| Dipodomys ordii | ENSDORG00000014912 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000027710 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000040204 | 7 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003982 | 1 retrocopy |
retro_ogar_501 ,
|
| Rattus norvegicus | ENSRNOG00000016561 | 5 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000019643 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013732 | 2 retrocopies |