RetrogeneDB ID: | retro_tbel_1870 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_5907:197797..198246(-) | ||
| Located in intron of: | ENSTBEG00000000229 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CAPZA1 | ||
| Ensembl ID: | ENSTBEG00000001727 | ||
| Aliases: | None | ||
| Description: | capping protein (actin filament) muscle Z-line, alpha 1 [Source:HGNC Symbol;Acc:1488] |
| Percent Identity: | 77.78 % |
| Parental protein coverage: | 59.76 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | NLLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASD-PQPEE |
| .LLREGAAHA.AQ.NMDQFTPVK...YED.VLITEHG.LGNSRF.D.RNKI.F.FD.L.KEASD.PQPEE | |
| Retrocopy | DLLREGAAHALAQ*NMDQFTPVKRRIYEDRVLITEHGNLGNSRFVDLRNKIFFTFDRLWKEASD<PQPEE |
| Parental | VDSGLKS-WRESCDSALRAYVKDHYSNGF-CTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT |
| ...GLKS.W.E.CDSALRA.V..H.SNGF..TVYAKT.DG.QTI.A.IESHQFQPKNFW.GRWRSEWKFT | |
| Retrocopy | IGGGLKS>WSEACDSALRACVDHHDSNGF<LTVYAKTMDGRQTITAHIESHQFQPKNFWDGRWRSEWKFT |
| Parental | ITPPTAQVVGVLK |
| ITP.T.QVVGVLK | |
| Retrocopy | ITPTTTQVVGVLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003570 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013548 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000014532 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000000671 | 3 retrocopies | |
| Felis catus | ENSFCAG00000013303 | 2 retrocopies | |
| Homo sapiens | ENSG00000116489 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023677 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000017963 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015668 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000070372 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004191 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000270 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000014074 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000001021 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000001110 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000013538 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001727 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000012657 | 2 retrocopies |