RetrogeneDB ID: | retro_sscr_998 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 8:71362324..71362618(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AP1S2 | ||
| Ensembl ID: | ENSSSCG00000012142 | ||
| Aliases: | None | ||
| Description: | adaptor-related protein complex 1, sigma 2 subunit [Source:HGNC Symbol;Acc:560] |
| Percent Identity: | 92.86 % |
| Parental protein coverage: | 62.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | RYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKN |
| RYASLYFCCAIEDQDNELITLEIIH.YVELLDKYF..VCELDIIFNFEK.YFILDEFLLG.EVQETSKKN | |
| Retrocopy | RYASLYFCCAIEDQDNELITLEIIHHYVELLDKYFDGVCELDIIFNFEKDYFILDEFLLGEEVQETSKKN |
| Parental | VLKAIEQADLLQEEAETPRSVLEEIGLT |
| VLKA.EQADLLQEE.ETPRSVLEEIGLT | |
| Retrocopy | VLKATEQADLLQEEVETPRSVLEEIGLT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 20 .18 RPM |
| SRP014902_testis | 0 .42 RPM | 25 .32 RPM |
| SRP018288_heart | 0 .03 RPM | 79 .45 RPM |
| SRP018288_kidney | 0 .00 RPM | 8 .96 RPM |
| SRP018288_liver | 0 .16 RPM | 3 .84 RPM |
| SRP018288_lung | 0 .00 RPM | 17 .21 RPM |
| SRP018856_adipose | 0 .03 RPM | 5 .62 RPM |
| SRP035408_brain | 0 .00 RPM | 33 .06 RPM |
| SRP035408_liver | 0 .00 RPM | 6 .69 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000020420 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004393 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000013888 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017197 | 7 retrocopies | |
| Otolemur garnettii | ENSOGAG00000011342 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000000733 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000010218 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000000117 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000013119 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000012142 | 1 retrocopy |
retro_sscr_998 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000008517 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008834 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005290 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007642 | 1 retrocopy |