RetrogeneDB ID: | retro_sscr_883 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 6:105646336..105646714(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GINS2 | ||
| Ensembl ID: | ENSSSCG00000002663 | ||
| Aliases: | None | ||
| Description: | GINS complex subunit 2 (Psf2 homolog) [Source:HGNC Symbol;Acc:24575] |
| Percent Identity: | 54.2 % |
| Parental protein coverage: | 69.19 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGD-LGPFNPGLPVQVPLWLAINLKQRQKCRLLAPEWMDVE |
| .D.A...F.A.KE.VTIIPNF.L.K.YL..G..LGPF.P.LPV..PLWL...LK.RQ..RLL.P...DVE | |
| Retrocopy | IDPADMTFAAQKETVTIIPNFVLGKVYLLRGT<LGPFHPCLPVKEPLWLEVHLKPRQG-RLLRPKQRDVE |
| Parental | KLEKMRDHERKEDT-FTPAPNPHYTELTKLL-LNHASDNIPKADEIRTLIKDVWDTRVAKL |
| KLE..R.HE.K..T.F.P.P.....ELT.L..L...S.NIPKAD.I.T...D...T..AKL | |
| Retrocopy | KLERIRGHEHKLET<FPPSPKAFSMELTNLR<LK*TSANIPKADAIQTQHRDTRETCRAKL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 2 .65 RPM |
| SRP014902_testis | 0 .00 RPM | 7 .07 RPM |
| SRP018288_heart | 0 .00 RPM | 0 .71 RPM |
| SRP018288_kidney | 0 .00 RPM | 2 .46 RPM |
| SRP018288_liver | 0 .00 RPM | 1 .60 RPM |
| SRP018288_lung | 0 .00 RPM | 3 .67 RPM |
| SRP018856_adipose | 0 .00 RPM | 0 .91 RPM |
| SRP035408_brain | 0 .00 RPM | 2 .57 RPM |
| SRP035408_liver | 0 .00 RPM | 3 .55 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000017303 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008760 | 4 retrocopies | |
| Homo sapiens | ENSG00000131153 | 1 retrocopy | |
| Gallus gallus | ENSGALG00000028131 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009069 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000014703 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000016691 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020594 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007616 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000008430 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000004944 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000015249 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000002663 | 1 retrocopy |
retro_sscr_883 ,
|
| Tupaia belangeri | ENSTBEG00000006220 | 1 retrocopy |