RetrogeneDB ID: | retro_sscr_744 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 3:120248184..120248446(-) | ||
| Located in intron of: | ENSSSCG00000008576 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PCBD1 | ||
| Ensembl ID: | ENSSSCG00000010275 | ||
| Aliases: | None | ||
| Description: | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [Source:HGNC Symbol;Acc:8646] |
| Percent Identity: | 79.12 % |
| Parental protein coverage: | 85.58 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MAGKAHRLSAEERDQLLPNLRAVGWNELEG-RDAIFKQFHFKDFNRAFGFMTRVALQAEKLDH-HPEWFN |
| MAGKAHRLSAEERDQL.PN.RAVGWNELEG..DAIFKQFHFKDFN.AFGF.TR.ALQAE.L.H.H.EWFN | |
| Retrocopy | MAGKAHRLSAEERDQLQPNPRAVGWNELEG<LDAIFKQFHFKDFNGAFGFTTRGALQAETLGH<HSEWFN |
| Parental | VYNKVHITLSTHECAGLSERD |
| ...KVH.TLS..EC.GLSE.D | |
| Retrocopy | LC-KVHHTLSSLECVGLSEWD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 18 .45 RPM |
| SRP014902_testis | 0 .00 RPM | 54 .88 RPM |
| SRP018288_heart | 0 .00 RPM | 21 .79 RPM |
| SRP018288_kidney | 0 .00 RPM | 81 .76 RPM |
| SRP018288_liver | 0 .00 RPM | 308 .15 RPM |
| SRP018288_lung | 0 .00 RPM | 34 .32 RPM |
| SRP018856_adipose | 0 .00 RPM | 97 .91 RPM |
| SRP035408_brain | 0 .00 RPM | 19 .18 RPM |
| SRP035408_liver | 0 .00 RPM | 183 .18 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011866 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012703 | 1 retrocopy | |
| Felis catus | ENSFCAG00000001235 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000001397 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016074 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000007201 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000010275 | 1 retrocopy |
retro_sscr_744 ,
|
| Takifugu rubripes | ENSTRUG00000017869 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000005775 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000004496 | 1 retrocopy |