RetrogeneDB ID: | retro_sscr_558 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 16:77000012..77000414(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSSSCG00000017077 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ISCA1 | ||
| Ensembl ID: | ENSSSCG00000010953 | ||
| Aliases: | None | ||
| Description: | iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:28660] |
| Percent Identity: | 89.63 % |
| Parental protein coverage: | 79.41 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VAGTAKMSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTL |
| VAG..KM.ASLV.ATV..VSKRKLQPT.AALT.TPSA.N.IKQLL.DKPE.VGVKVGVRTRGCNGLSYTL | |
| Retrocopy | VAGMVKMLASLVWATVQSVSKRKLQPTWAALTMTPSA-NEIKQLLRDKPELVGVKVGVRTRGCNGLSYTL |
| Parental | EYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI |
| EYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPN.KGT.GCGESFNI | |
| Retrocopy | EYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNLKGTWGCGESFNI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 19 .64 RPM |
| SRP014902_testis | 0 .14 RPM | 37 .77 RPM |
| SRP018288_heart | 0 .24 RPM | 153 .55 RPM |
| SRP018288_kidney | 0 .00 RPM | 54 .28 RPM |
| SRP018288_liver | 0 .16 RPM | 43 .18 RPM |
| SRP018288_lung | 0 .00 RPM | 34 .72 RPM |
| SRP018856_adipose | 0 .00 RPM | 35 .79 RPM |
| SRP035408_brain | 0 .00 RPM | 39 .89 RPM |
| SRP035408_liver | 0 .00 RPM | 34 .70 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046526 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000001336 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001940 | 6 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000010652 | 5 retrocopies | |
| Equus caballus | ENSECAG00000011465 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000016537 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007518 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000003559 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044792 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019339 | 5 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000004588 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000018343 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000010953 | 1 retrocopy |
retro_sscr_558 ,
|
| Tarsius syrichta | ENSTSYG00000012826 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004231 | 1 retrocopy |