RetrogeneDB ID: | retro_sscr_31 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 7:5756283..5756694(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSSSCG00000001032 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | H3F3A | ||
| Ensembl ID: | ENSSSCG00000023971 | ||
| Aliases: | None | ||
| Description: | Sus scrofa H3 histone, family 3A (H3F3A), mRNA. [Source:RefSeq mRNA;Acc:NM_213930] |
| Percent Identity: | 97.79 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR |
| .ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR | |
| Retrocopy | VARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR |
| Parental | LVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| LVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLA..IRGERA | |
| Retrocopy | LVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLAHCIRGERA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 24 .29 RPM | 31 .32 RPM |
| SRP014902_testis | 10 .33 RPM | 34 .51 RPM |
| SRP018288_heart | 16 .37 RPM | 86 .05 RPM |
| SRP018288_kidney | 27 .09 RPM | 112 .89 RPM |
| SRP018288_liver | 16 .95 RPM | 57 .73 RPM |
| SRP018288_lung | 30 .55 RPM | 184 .51 RPM |
| SRP018856_adipose | 2 .89 RPM | 67 .83 RPM |
| SRP035408_brain | 1 .21 RPM | 19 .12 RPM |
| SRP035408_liver | 1 .20 RPM | 24 .19 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000024561 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000004916 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000016119 | 4 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000013796 | 1 retrocopy | |
| Felis catus | ENSFCAG00000003617 | 4 retrocopies | |
| Felis catus | ENSFCAG00000030424 | 5 retrocopies | |
| Gadus morhua | ENSGMOG00000014306 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000004090 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000031483 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001577 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000024312 | 11 retrocopies | |
| Otolemur garnettii | ENSOGAG00000025933 | 14 retrocopies | |
| Oreochromis niloticus | ENSONIG00000015805 | 7 retrocopies | |
| Pongo abelii | ENSPPYG00000008636 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000008459 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000023971 | 2 retrocopies |
retro_sscr_31 , retro_sscr_712,
|