RetrogeneDB ID: | retro_sscr_1163 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | X:68244853..68245179(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000023323 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.64 % |
| Parental protein coverage: | 88.62 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | MGAPGGKINRP-RTELKKKLF-KRRRVLSRERRLRHRVVGAVIDEGLITRHHLKKRASSARANITLSGKK |
| .GAPG.KINRP.RTELK.KLF.KR..VLS..RR..H.VVGA.IDEGLITRH..KK.ASS..ANITLSGKK | |
| Retrocopy | IGAPGRKINRP<RTELKEKLF>KRWWVLS*GRRPKHHVVGAAIDEGLITRHPFKKWASSECANITLSGKK |
| Parental | RRKLLQQIRLAQKEKAAME-VEAPYKPARTSNSQPKLKKKPK |
| ..KLLQQI.L..KEKA.ME.VEA.YKP..T...QP.LK.K.K | |
| Retrocopy | CKKLLQQIWLT*KEKAPME<VEASYKPVKTTEPQPNLKRKTK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 13 .94 RPM |
| SRP014902_testis | 0 .00 RPM | 15 .98 RPM |
| SRP018288_heart | 0 .00 RPM | 10 .35 RPM |
| SRP018288_kidney | 0 .00 RPM | 26 .10 RPM |
| SRP018288_liver | 0 .00 RPM | 18 .23 RPM |
| SRP018288_lung | 0 .00 RPM | 24 .23 RPM |
| SRP018856_adipose | 0 .00 RPM | 22 .21 RPM |
| SRP035408_brain | 0 .00 RPM | 39 .38 RPM |
| SRP035408_liver | 0 .00 RPM | 27 .01 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006512 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000010465 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000015719 | 2 retrocopies | |
| Felis catus | ENSFCAG00000025454 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000013949 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000071653 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000033103 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019701 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000023323 | 2 retrocopies |
retro_sscr_1162, retro_sscr_1163 ,
|