RetrogeneDB ID: | retro_sara_319 | ||
Retrocopy location | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | scaffold_160823:6558..6802(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSARG00000005798 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 65.85 % |
| Parental protein coverage: | 54.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | LSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGT-TVHVGIHPS |
| .SKE..QKYNV.SM.I.K...VQVVRGHY.G.Q.GKV.Q..R.K.VIYIE....EKANGT.TVHVG.HPS | |
| Retrocopy | ISKEPSQKYNVASMAI*KNSKVQVVRGHYIGPQTGKVAQDDREKHVIYIEQFKWEKANGT>TVHVGTHPS |
| Parental | KVVITRLKLDKD |
| KVVI.R....KD | |
| Retrocopy | KVVIIRQYCKKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |