RetrogeneDB ID: | retro_rnor_786 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 11:25301955..25302169(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ubl5 | ||
| Ensembl ID: | ENSRNOG00000020442 | ||
| Aliases: | Ubl5, beacon | ||
| Description: | ubiquitin-like protein 5 [Source:RefSeq peptide;Acc:NP_001041708] |
| Percent Identity: | 56.94 % |
| Parental protein coverage: | 97.26 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | EVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVL-KKWYTIFKDHVSLGDYEIHDGMNLELY |
| ...CND.L.KK.....NT..TI.DL.KL..A..G..WNK.VL.KKWYTIF.DHVSL....I...MNLEL. | |
| Retrocopy | DLFCNDHL*KKGHTN*NTNETIRDLEKLKVA*IGNCWNKVVL>KKWYTIFNDHVSLAGHDIYNAMNLELW |
| Parental | YQ |
| YQ | |
| Retrocopy | YQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 42 .85 RPM |
| SRP017611_kidney | 0 .00 RPM | 45 .78 RPM |
| SRP017611_liver | 0 .00 RPM | 26 .42 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012371 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000032630 | 5 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000006384 | 5 retrocopies | |
| Dipodomys ordii | ENSDORG00000006499 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005999 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012892 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000015506 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000027369 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000084786 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029004 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000013412 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000020442 | 1 retrocopy |
retro_rnor_786 ,
|
| Sarcophilus harrisii | ENSSHAG00000010974 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000005286 | 1 retrocopy |