RetrogeneDB ID: | retro_rnor_1605 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 2:14295648..14295876(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | H2afz | ||
| Ensembl ID: | ENSRNOG00000010306 | ||
| Aliases: | None | ||
| Description: | Histone H2A.Z [Source:UniProtKB/Swiss-Prot;Acc:P0C0S7] |
| Percent Identity: | 76.92 % |
| Parental protein coverage: | 61.42 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | AAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG |
| AAVYSAAILE.LT..VLELAGNASKDLK.K.ITP.HLQLAI.GDEE.D......IAGGGVIPHIH..L.G | |
| Retrocopy | AAVYSAAILE*LTEIVLELAGNASKDLKIK*ITP-HLQLAIHGDEEFDT-DSGYIAGGGVIPHIHQALTG |
| Parental | KKGQQKTV |
| KKGQ.KTV | |
| Retrocopy | KKGQKKTV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 33 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 31 .89 RPM |
| SRP017611_liver | 0 .00 RPM | 17 .21 RPM |