RetrogeneDB ID: | retro_rnor_1403 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 18:61469196..61469376(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Lsm7 | ||
| Ensembl ID: | ENSRNOG00000019552 | ||
| Aliases: | None | ||
| Description: | U6 snRNA-associated Sm-like protein LSm7 [Source:RefSeq peptide;Acc:NP_001102202] |
| Percent Identity: | 65.0 % |
| Parental protein coverage: | 58.25 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | ILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQL |
| ILDLSKYIDKTI..KF....E..GIL..FDPL.NL.LDGT.E...DP.DQYKL.E.T.Q. | |
| Retrocopy | ILDLSKYIDKTIHMKF*DDWEPRGILREFDPLSNLALDGTTELVQDPNDQYKLIEGTQQM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 10 .78 RPM |
| SRP017611_kidney | 0 .00 RPM | 5 .58 RPM |
| SRP017611_liver | 0 .00 RPM | 4 .50 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Myotis lucifugus | ENSMLUG00000013097 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000035215 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000144 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000019552 | 1 retrocopy |
retro_rnor_1403 ,
|