RetrogeneDB ID: | retro_rnor_1087 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 15:10370275..10370520(+) | ||
| Located in intron of: | ENSRNOG00000014661 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Snapc5 | ||
| Ensembl ID: | ENSRNOG00000010156 | ||
| Aliases: | None | ||
| Description: | snRNA-activating protein complex subunit 5 [Source:RefSeq peptide;Acc:NP_001103113] |
| Percent Identity: | 66.27 % |
| Parental protein coverage: | 81.82 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | KAALHDQLNRLKVEELALQSMINSRGRTETLPSQPAPEQLCDMSLQVDNEASINQTAL-KLSTRSPMEEE |
| K..L.DQL..LKVE..ALQSMI.S...TETL.SQ.APE.L.DMSL..DNEASINQ..L.KLSTRSP.E.. | |
| Retrocopy | KDVLYDQLDHLKVEG*ALQSMISSQKGTETLSSQLAPE*LHDMSLNIDNEASINQGTL<KLSTRSPVEVK |
| Parental | EEEEEEE-EESDS |
| EEE...E.EES.S | |
| Retrocopy | EEEGVVE*EESVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 24 .23 RPM |
| SRP017611_kidney | 0 .00 RPM | 14 .72 RPM |
| SRP017611_liver | 0 .00 RPM | 6 .66 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Mus musculus | retro_mmus_702 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000017304 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007484 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000006689 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003693 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003990 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016841 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032398 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012935 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000008791 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000010156 | 1 retrocopy |
retro_rnor_1087 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000009201 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014333 | 1 retrocopy |