RetrogeneDB ID: | retro_ggor_2398 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 6:6489805..6490086(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNAPC5 | ||
| Ensembl ID: | ENSGGOG00000003693 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.53 % |
| Parental protein coverage: | 91.84 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | QELRKEEETLLRLKAAL-HDLLNRLKVEELALQSMISSRRGDEMLS---SHTVPEQSHDMLVHVDNEASI |
| QELR.EEETLL..KAA..HDLLN..KVE.LALQS.ISSRRGDE.LS...S.TVPEQSH.M.VH.DNEAS. | |
| Retrocopy | QELREEEETLLLSKAAP>HDLLNHIKVEALALQSTISSRRGDEVLSPPTSPTVPEQSHVMSVHIDNEASV |
| Parental | NQTTLELSTKS-HVTEEEEEEEEEE |
| NQTTLE.S..S....EEEEE.EE.. | |
| Retrocopy | NQTTLEWSIES>VTEEEEEEKEESD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 2 .59 RPM | 15 .25 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 9 .97 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .66 RPM |
| SRP007412_kidney | 0 .12 RPM | 8 .95 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .51 RPM |
| SRP007412_testis | 0 .10 RPM | 15 .85 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Macaca mulatta | retro_mmul_1815 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000017304 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007484 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000006689 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003693 | 1 retrocopy |
retro_ggor_2398 ,
|
| Macropus eugenii | ENSMEUG00000003990 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016841 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032398 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012935 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000008791 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000010156 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000009201 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014333 | 1 retrocopy |