RetrogeneDB ID: | retro_ptro_2870 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 9:5928113..5928474(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AK4 | ||
| Ensembl ID: | ENSPTRG00000000827 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.24 % |
| Parental protein coverage: | 54.26 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | NKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKP-EAVAA |
| .KI.EVDLVI.L.IPFETLKD.LSR.WIHPP..RVYNL.FNPP.VHGIDD..GEPLVQQEDDK..EAVAA | |
| Retrocopy | DKIYEVDLVICLKIPFETLKDCLSRCWIHPPCSRVYNLGFNPPGVHGIDDISGEPLVQQEDDKS<EAVAA |
| Parental | RLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYT-LFSNKITPIQSKE |
| R.RQYK.VAKPVI.L.KS.G.LH.FSG.ET.KIWP.VY...F.NKITPIQSKE | |
| Retrocopy | RIRQYKVVAKPVI*LCKSPGLLHHFSGMETDKIWP*VYI<IFLNKITPIQSKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 5 .79 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 23 .30 RPM |
| SRP007412_heart | 0 .00 RPM | 21 .66 RPM |
| SRP007412_kidney | 0 .05 RPM | 169 .07 RPM |
| SRP007412_liver | 0 .03 RPM | 20 .95 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .54 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4225 |
| Gorilla gorilla | retro_ggor_2829 |
| Pongo abelii | retro_pabe_3412 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000016835 | 1 retrocopy | |
| Homo sapiens | ENSG00000162433 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000026644 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000009622 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001079 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000028527 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015163 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016024 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000010345 | 17 retrocopies | |
| Pongo abelii | ENSPPYG00000001269 | 6 retrocopies | |
| Pan troglodytes | ENSPTRG00000000827 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000020742 | 5 retrocopies |