RetrogeneDB ID: | retro_ptro_2578 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 7:142817383..142817686(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFB10 | ||
| Ensembl ID: | ENSPTRG00000007618 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001071824] |
| Percent Identity: | 57.8 % |
| Parental protein coverage: | 61.05 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MPDSWDKDVYPEP--PRRTPVQPN-LIVYMMKAFDLIVDRPVTLVREFIERQHAK-NRYYYYHRQYRRVP |
| MP.SWDKDVYP....PR..P..PN..I.Y.MKAFDL........VREFI..QH.K...YY.YH..YR..P | |
| Retrocopy | MPESWDKDVYPKSPCPRCRPCSPN<PITYLMKAFDLL----MAFVREFIKGQHVK>RYYY-YHWEYRHMP |
| Parental | DITECKEEDIMCMYEAEMQWRRDYKVDQEIINIMQDRLK |
| DI.ECK.ED..CM..AEMQWRRD.K..QEI....Q.RLK | |
| Retrocopy | DIIECK-EDVLCMFGAEMQWRRDHKISQEIVDLIQERLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .07 RPM | 54 .87 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 37 .39 RPM |
| SRP007412_heart | 0 .00 RPM | 111 .19 RPM |
| SRP007412_kidney | 0 .00 RPM | 91 .98 RPM |
| SRP007412_liver | 0 .00 RPM | 49 .13 RPM |
| SRP007412_testis | 0 .00 RPM | 38 .46 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3801 |
| Gorilla gorilla | retro_ggor_2555 |
| Pongo abelii | retro_pabe_3106 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000019476 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000017154 | 1 retrocopy | |
| Felis catus | ENSFCAG00000011738 | 1 retrocopy | |
| Homo sapiens | ENSG00000140990 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009367 | 2 retrocopies | |
| Latimeria chalumnae | ENSLACG00000013152 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029268 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000040048 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008867 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006974 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000007618 | 2 retrocopies |
retro_ptro_1060, retro_ptro_2578 ,
|
| Rattus norvegicus | ENSRNOG00000014568 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030328 | 1 retrocopy |