RetrogeneDB ID: | retro_mmus_2566 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 5:50921538..50921901(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ndufb10 | ||
| Ensembl ID: | ENSMUSG00000040048 | ||
| Aliases: | Ndufb10, 0610011B04Rik, 22kDa, PDSW | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 [Source:MGI Symbol;Acc:MGI:1915592] |
| Percent Identity: | 60.0 % |
| Parental protein coverage: | 68.75 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 4 |
| Parental | QHAKNRTYYYHRQYRRVPDITECKEGDVLCIYEAEMQWRRDFKVDQEIMNIIQERLKACQQREG-ENYQQ |
| QHA.N.T.YY......V.D..E.K.GDVLC..E.EMQ.RRD..VDQ.I..IIQERLKACQQ..G.....Q | |
| Retrocopy | QHANN*TCYYQQ**GHVLDPAEYKKGDVLCSVEPEMQLRRDYRVDQNIISIIQERLKACQQKKG<SKHKQ |
| Parental | NCAKELEQFTKVTK-AYQDRYLDLGAYY-SARKCLAKQKQRMLE-ERKAARQEAA |
| NCAK..EQFTKV.K..Y.D...DLGAYY.SARKCL.KQKQ..LE..R.AA....A | |
| Retrocopy | NCAKAPEQFTKVAK>SYHDQFYDLGAYY>SARKCLTKQKQERLE<KRMAAEETLA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 86 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 119 .50 RPM |
| SRP007412_heart | 0 .00 RPM | 504 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 265 .22 RPM |
| SRP007412_liver | 0 .00 RPM | 124 .01 RPM |
| SRP007412_testis | 0 .00 RPM | 72 .63 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_1056 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000019476 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000017154 | 1 retrocopy | |
| Felis catus | ENSFCAG00000011738 | 1 retrocopy | |
| Homo sapiens | ENSG00000140990 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009367 | 2 retrocopies | |
| Latimeria chalumnae | ENSLACG00000013152 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029268 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000040048 | 1 retrocopy |
retro_mmus_2566 ,
|
| Nomascus leucogenys | ENSNLEG00000008867 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006974 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000007618 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014568 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030328 | 1 retrocopy |