RetrogeneDB ID: | retro_ptro_253 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:202215465..202215695(+) | ||
| Located in intron of: | ENSPTRG00000002013 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFB1 | ||
| Ensembl ID: | ENSPTRG00000006649 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa (NDUFB1), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001076782] |
| Percent Identity: | 57.69 % |
| Parental protein coverage: | 73.33 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | EFPVALGLGVAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQP |
| E....LG.GV.VG..A.A.MV..L..V..HWVH.LV..GFV..C.L.RK.DE.LTAF...S.LFKREL.P | |
| Retrocopy | ELVTTLGCGVIVGTGAFAVMVD*LETVYEHWVHRLVRIGFVFVCCLKRKNDEKLTAFWKNSILFKRELRP |
| Parental | SE-EVTWK |
| .E.EV.WK | |
| Retrocopy | ME<EVAWK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 35 .30 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 18 .53 RPM |
| SRP007412_heart | 0 .06 RPM | 80 .85 RPM |
| SRP007412_kidney | 0 .05 RPM | 56 .72 RPM |
| SRP007412_liver | 0 .00 RPM | 32 .64 RPM |
| SRP007412_testis | 0 .11 RPM | 10 .43 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_311 |
| Macaca mulatta | retro_mmul_538 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014837 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018067 | 5 retrocopies | |
| Homo sapiens | ENSG00000183648 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000022428 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000017129 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012731 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000006076 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006649 | 2 retrocopies |
retro_ptro_1782, retro_ptro_253 ,
|
| Pteropus vampyrus | ENSPVAG00000015319 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000008130 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000003502 | 2 retrocopies |