RetrogeneDB ID: | retro_cjac_2586 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:1789441..1789673(-) | ||
| Located in intron of: | ENSCJAG00000017803 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFB1 | ||
| Ensembl ID: | ENSCJAG00000018067 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa [Source:HGNC Symbol;Acc:7695] |
| Percent Identity: | 98.72 % |
| Parental protein coverage: | 72.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | EFSVVLGV-PVAVATGPAAIMVNFLQLLRDQWVVLFVPMGFVLGCYLDRKNDEKLTAFRNKSMLYKRELR |
| EFSVVLGV.PVAVATGPAAIMVNFLQLLRDQWVVLFVPMGFVLGCYLDRKNDEKLTAFRNKSMLYKRELR | |
| Retrocopy | EFSVVLGV>PVAVATGPAAIMVNFLQLLRDQWVVLFVPMGFVLGCYLDRKNDEKLTAFRNKSMLYKRELR |
| Parental | PNEEYTWK |
| PNEEYTWK | |
| Retrocopy | PNEEYTWK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .20 RPM | 9 .61 RPM |
| SRP051959_heart | 0 .09 RPM | 23 .71 RPM |
| SRP051959_kidney | 0 .16 RPM | 19 .21 RPM |
| SRP051959_liver | 0 .11 RPM | 16 .57 RPM |
| SRP051959_lung | 0 .15 RPM | 7 .58 RPM |
| SRP051959_lymph_node | 0 .14 RPM | 9 .29 RPM |
| SRP051959_skeletal_muscle | 0 .15 RPM | 33 .59 RPM |
| SRP051959_spleen | 0 .13 RPM | 11 .01 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014837 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018067 | 5 retrocopies | |
| Homo sapiens | ENSG00000183648 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000022428 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000017129 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012731 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000006076 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006649 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000015319 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000008130 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000003502 | 2 retrocopies |