RetrogeneDB ID: | retro_ptro_150 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:53362631..53362820(+) | ||
| Located in intron of: | ENSPTRG00000000747 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMA7 | ||
| Ensembl ID: | ENSPTRG00000041769 | ||
| Aliases: | TMA7, CCDC72 | ||
| Description: | translation machinery associated 7 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:26932] |
| Percent Identity: | 90.62 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK |
| MSG.EGGKK.PLK.PKKQAKEMDEEDKAFKQKQKEEQKKLEELK.KA.GKGPLAT.GIKKSGKK | |
| Retrocopy | MSGHEGGKK-PLKRPKKQAKEMDEEDKAFKQKQKEEQKKLEELKWKATGKGPLATSGIKKSGKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 72 .95 RPM |
| SRP007412_cerebellum | 0 .29 RPM | 57 .07 RPM |
| SRP007412_heart | 0 .23 RPM | 41 .68 RPM |
| SRP007412_kidney | 1 .18 RPM | 68 .39 RPM |
| SRP007412_liver | 1 .77 RPM | 41 .47 RPM |
| SRP007412_testis | 0 .53 RPM | 78 .09 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_154 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001193 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002871 | 18 retrocopies |
retro_cjac_1370, retro_cjac_1449, retro_cjac_1504, retro_cjac_1667, retro_cjac_1670, retro_cjac_1704, retro_cjac_1918, retro_cjac_2092, retro_cjac_2258, retro_cjac_2422, retro_cjac_2629, retro_cjac_2673, retro_cjac_2692, retro_cjac_2799, retro_cjac_3651, retro_cjac_536, retro_cjac_81, retro_cjac_849,
|
| Felis catus | ENSFCAG00000026902 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028044 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000091537 | 11 retrocopies | |
| Pan troglodytes | ENSPTRG00000041769 | 9 retrocopies |
retro_ptro_136, retro_ptro_1492, retro_ptro_150 , retro_ptro_1638, retro_ptro_1953, retro_ptro_1976, retro_ptro_2312, retro_ptro_2535, retro_ptro_2691,
|
| Rattus norvegicus | ENSRNOG00000042689 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000047225 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011351 | 6 retrocopies |