RetrogeneDB ID: | retro_fcat_138 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B2:102187133..102187328(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSFCAG00000028367 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000026902 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.69 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK |
| MS..EGGKK.PLKQP.KQAK..DEEDKA.KQKQK.EQKKL.ELKAKA.G.G.LATGGIKKS.KK | |
| Retrocopy | MSDHEGGKKEPLKQPMKQAKDTDEEDKALKQKQKGEQKKLKELKAKAMGMGLLATGGIKKSDKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 19 .17 RPM |
| SRP017611_kidney | 0 .00 RPM | 42 .56 RPM |
| SRP017611_liver | 0 .00 RPM | 12 .74 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001193 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002871 | 18 retrocopies |
retro_cjac_1370, retro_cjac_1449, retro_cjac_1504, retro_cjac_1667, retro_cjac_1670, retro_cjac_1704, retro_cjac_1918, retro_cjac_2092, retro_cjac_2258, retro_cjac_2422, retro_cjac_2629, retro_cjac_2673, retro_cjac_2692, retro_cjac_2799, retro_cjac_3651, retro_cjac_536, retro_cjac_81, retro_cjac_849,
|
| Felis catus | ENSFCAG00000026902 | 5 retrocopies | |
| Homo sapiens | ENSG00000232112 | 11 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028044 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000091537 | 11 retrocopies | |
| Pan troglodytes | ENSPTRG00000041769 | 9 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042689 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000047225 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011351 | 6 retrocopies |