RetrogeneDB ID: | retro_pcap_242 | ||
Retrocopy location | Organism: | Hyrax (Procavia capensis) | |
| Coordinates: | scaffold_20739:22009..22407(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MYL6B | ||
| Ensembl ID: | ENSPCAG00000005927 | ||
| Aliases: | None | ||
| Description: | myosin, light chain 6B, alkali, smooth muscle and non-muscle [Source:HGNC Symbol;Acc:29823] |
| Percent Identity: | 55.07 % |
| Parental protein coverage: | 64.56 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 4 |
| Parental | ELFDRVGDGKILYGQCG-DVMRA-GQNPTNAEVLKVLGNPKSDEL-KSRRVDFETFLPMLQAVAKNRDQG |
| .LFD..GDG.I.Y.Q.G.D.MRA.GQN.T.A.VLKVLGNPKS.E........FE.FLP.L..VAKN.DQG | |
| Retrocopy | QLFDPMGDGNIVYSQDG<DLMRALGQNCTSAKVLKVLGNPKSGEM<ECEGAEFEHFLPFLHTVAKNKDQG |
| Parental | NYQDYLEGLRVFDKEGNGKVMGAEL-RHVLTTLGERLTEEEVESILAGH-EDINGCINYEAFLKHILS |
| .YQD...GL.VFDK.GNG..M..E...HVL.T.G...TEEEVE...AGH..D..G.I..E......L. | |
| Retrocopy | TYQDCVKGLQVFDKKGNGPIMDTEI<QHVLVTPGVKTTEEEVEMLVAGH<QDSSGHISCEKLIHMVLN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000000110 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011620 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007592 | 1 retrocopy | |
| Homo sapiens | ENSG00000196465 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003277 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000012658 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005214 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000026948 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017368 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001521 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000005927 | 2 retrocopies |
retro_pcap_223, retro_pcap_242 ,
|
| Pongo abelii | ENSPPYG00000004646 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000023043 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000028837 | 2 retrocopies |