RetrogeneDB ID: | retro_cjac_2566 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:120015997..120016444(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MYL6B | ||
| Ensembl ID: | ENSCJAG00000011620 | ||
| Aliases: | None | ||
| Description: | myosin, light chain 6B, alkali, smooth muscle and non-muscle [Source:HGNC Symbol;Acc:29823] |
| Percent Identity: | 76.16 % |
| Parental protein coverage: | 98.68 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | DFTEDQTAEFKEAFQLFDRTGDGKIL-YSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFL |
| DFT.DQT.EFKEAFQLF..T.DGK.....QC.D.MRALGQNP.N.EVLK.LGNPKSDEMNV..LDFEHFL | |
| Retrocopy | DFTRDQTTEFKEAFQLFH*TSDGKMS>HNQCEDTMRALGQNPPNTEVLKILGNPKSDEMNVRGLDFEHFL |
| Parental | PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINY |
| .MLQ.VAKNKDQ.TYEDYVE....FDKE.NGT.MG.EI...L.TLGEKMTEEEVEMLVAGHEDSNG.IN. | |
| Retrocopy | LMLQMVAKNKDQSTYEDYVEAIQMFDKE*NGTIMGIEISQGLITLGEKMTEEEVEMLVAGHEDSNGSINH |
| Parental | EAF-VRHILSG |
| EA...RHILSG | |
| Retrocopy | EAL<GRHILSG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 122 .52 RPM |
| SRP051959_heart | 0 .02 RPM | 131 .80 RPM |
| SRP051959_kidney | 0 .00 RPM | 108 .98 RPM |
| SRP051959_liver | 0 .00 RPM | 77 .09 RPM |
| SRP051959_lung | 0 .00 RPM | 116 .12 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 84 .95 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 41 .12 RPM |
| SRP051959_spleen | 0 .00 RPM | 114 .50 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1786 |
| Pan troglodytes | retro_ptro_1196 |
| Gorilla gorilla | retro_ggor_2233 |
| Pongo abelii | retro_pabe_1467 |
| Macaca mulatta | retro_mmul_211 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000000110 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011620 | 3 retrocopies |
retro_cjac_113, retro_cjac_2566 , retro_cjac_2848,
|
| Dasypus novemcinctus | ENSDNOG00000007592 | 1 retrocopy | |
| Homo sapiens | ENSG00000196465 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003277 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000012658 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005214 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000026948 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017368 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001521 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000005927 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000004646 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000023043 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000028837 | 2 retrocopies |