RetrogeneDB ID: | retro_pabe_883 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 12:116560828..116561227(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | OSTF1 | ||
| Ensembl ID: | ENSPPYG00000019300 | ||
| Aliases: | None | ||
| Description: | osteoclast-stimulating factor 1 [Source:RefSeq peptide;Acc:NP_001127367] |
| Percent Identity: | 84.33 % |
| Parental protein coverage: | 71.28 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | ESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEMLFTQPNIELNQQNKLG |
| .SIDN.LHE.AKRGNLSWL.ECLDNRVGVNGLDKAGSTAL..ACHG...DIVEMLFTQP.I.L.QQNKL. | |
| Retrocopy | QSIDNLLHEVAKRGNLSWLQECLDNRVGVNGLDKAGSTALD*ACHGDLRDIVEMLFTQPSI*LKQQNKLE |
| Parental | DTALHAAAWKGYADIVQLLLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDAVRTLSNA |
| DTALHAAAWK.YADIVQLLLAKGARTD.RN.EKKLA..MATNA..ASLLKKKQ.TDAVRTLSNA | |
| Retrocopy | DTALHAAAWKSYADIVQLLLAKGARTD*RNNEKKLALGMATNAH-ASLLKKKQETDAVRTLSNA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 20 .84 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 13 .13 RPM |
| SRP007412_heart | 0 .00 RPM | 8 .73 RPM |
| SRP007412_kidney | 0 .00 RPM | 23 .27 RPM |
| SRP007412_liver | 0 .00 RPM | 24 .85 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1058 |
| Pan troglodytes | retro_ptro_720 |
| Gorilla gorilla | retro_ggor_836 |
| Macaca mulatta | retro_mmul_836 |
| Callithrix jacchus | retro_cjac_3249 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000012808 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000007226 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000002933 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000008320 | 2 retrocopies | |
| Felis catus | ENSFCAG00000022374 | 1 retrocopy | |
| Homo sapiens | ENSG00000134996 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011920 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010401 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001854 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000002603 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019300 | 1 retrocopy |
retro_pabe_883 ,
|
| Pan troglodytes | ENSPTRG00000021031 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012156 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000005273 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003081 | 1 retrocopy |