RetrogeneDB ID: | retro_pabe_2504 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 4:10038151..10038394(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HRSP12 | ||
| Ensembl ID: | ENSPPYG00000018776 | ||
| Aliases: | None | ||
| Description: | heat-responsive protein 12 [Source:HGNC Symbol;Acc:16897] |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 59.12 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG |
| MSSLI..VI.TAKAP...GPY.Q.VLV.RTI.ISGQ..MD.S..QLV.G....EAKQAL..MGE.LK.AG | |
| Retrocopy | MSSLIKKVIRTAKAPRVLGPYGQGVLVNRTIHISGQLIMDSSNAQLVAGEIPKEAKQALTKMGEVLKTAG |
| Parental | CDFTNVVKTTV |
| CDFTNVV...V | |
| Retrocopy | CDFTNVVNNFV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 19 .52 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 16 .66 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .01 RPM |
| SRP007412_kidney | 0 .07 RPM | 161 .29 RPM |
| SRP007412_liver | 0 .00 RPM | 155 .55 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3022 |
| Pan troglodytes | retro_ptro_2040 |