RetrogeneDB ID: | retro_pabe_2326 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:99092322..99092672(-) | ||
| Located in intron of: | ENSPPYG00000013917 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000007237 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.56 % |
| Parental protein coverage: | 77.48 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | AEVAPVRQQGSAAAVRGVVSRLGCRPSWTTAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCACSFRVLV |
| A.V....Q.G.A....GV.S.LG..PSWT.A.ELSAE.L..KLQ.D.EA.H.EVED.TLN.CACSF.VLV | |
| Retrocopy | APVGVQKQRGQAGV*AGVLSLLGYGPSWTAATELSAE*LQKKLQWDPEAKHIEVEDVTLNHCACSF*VLV |
| Parental | VSAKFEGKPLLQRHRLVNACLAE-ELPHIHAFEQKTLTPEQWARQRQK |
| V.AKF.GK.LLQ.H..VN.CLA...L.HIH.FEQKTL.PEQWA...QK | |
| Retrocopy | VLAKFKGKLLLQTHWWVNMCLAG<RLSHIHTFEQKTLIPEQWACEWQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .47 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .53 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .49 RPM |
| SRP007412_kidney | 0 .00 RPM | 8 .49 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .46 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Callithrix jacchus | retro_cjac_1327 |
| Macaca mulatta | retro_mmul_1522 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000006661 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006548 | 1 retrocopy | |
| Homo sapiens | ENSG00000169627 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012724 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000017910 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003449 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007331 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000015658 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001018 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007562 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000002109 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007237 | 2 retrocopies |
retro_pabe_1608, retro_pabe_2326 ,
|
| Pan troglodytes | ENSPTRG00000007990 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000047988 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000003579 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006274 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000005543 | 2 retrocopies |