RetrogeneDB ID: | retro_cjac_1327 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 15:23159992..23160321(+) | ||
| Located in intron of: | ENSCJAG00000002465 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000006661 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.12 % |
| Parental protein coverage: | 76.32 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | VAPVRAQSPVAGVLAGVLSPLGYRPGWHTAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCACSFRVLVV |
| VAPV..Q...AG..A..LS..G..P.....M.L.A......LQ..L.....EVED.TLN.C.CSF.VLVV | |
| Retrocopy | VAPVGVQRSMAGI*ARALS--GLWPQLDAVMKLIAA---KYLQGKLQQD-LEVEDVTLNHCGCSF*VLVV |
| Parental | SAKFEGKPLLQRHRLVNACLA-EELPQIHAFEQKTLTPEQWARERQK |
| SAKFEGK.LLQR.R.VN.CLA...LP.I.AFEQKTLTPEQ.A.E.QK | |
| Retrocopy | SAKFEGKVLLQRQRRVNVCLA<RKLPHIRAFEQKTLTPEQ*AFEGQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .11 RPM | 3 .55 RPM |
| SRP051959_heart | 0 .07 RPM | 2 .61 RPM |
| SRP051959_kidney | 0 .07 RPM | 5 .77 RPM |
| SRP051959_liver | 0 .04 RPM | 3 .18 RPM |
| SRP051959_lung | 0 .07 RPM | 3 .42 RPM |
| SRP051959_lymph_node | 0 .09 RPM | 4 .82 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 3 .10 RPM |
| SRP051959_spleen | 0 .15 RPM | 4 .05 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Macaca mulatta | retro_mmul_1522 |
| Pongo abelii | retro_pabe_2326 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000006661 | 1 retrocopy |
retro_cjac_1327 ,
|
| Echinops telfairi | ENSETEG00000006548 | 1 retrocopy | |
| Homo sapiens | ENSG00000169627 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012724 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000017910 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003449 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007331 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000015658 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001018 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007562 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000002109 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007237 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000007990 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000047988 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000003579 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006274 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000005543 | 2 retrocopies |