RetrogeneDB ID: | retro_pabe_1914 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 22:38166496..38166905(-) | ||
| Located in intron of: | ENSPPYG00000011903 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COA1 | ||
| Ensembl ID: | ENSPPYG00000017606 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase assembly factor 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:21868] |
| Percent Identity: | 68.35 % |
| Parental protein coverage: | 97.84 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | WQKYAGSRRSMPLGARI-LFHSVFCAGGFAIVYYLVQKFHSRGLYYKLAVEQLQSHPEAQEALGPPLNIH |
| WQKY.GSR...P.G....LF..VF...G.A.VYYL.QK..SR.LYY.LA.EQ..SHP.AQ.ALGPPLNIH | |
| Retrocopy | WQKYPGSRMPVPQGKNA>LFGNVFSTEGLALVYYLIQKTFSRALYYRLALEQVHSHPKAQGALGPPLNIH |
| Parental | YLKLIDRENFVDIADAKLKIPVSGSKSEGLLYIHSSRGG-PFQRWHLDEVFLELKD-VSRFLCSSSVGK |
| .LKL....NFVDIADAKLKIP.SGSKSEG.L...SSR...PFQRWHLDEVFLE.KD..SRF.CSSSVG. | |
| Retrocopy | CLKLTNKHNFVDIADAKLKIPSSGSKSEGHLHVSSSRSA<PFQRWHLDEVFLEPKD>ASRFPCSSSVGR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 14 .82 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 15 .20 RPM |
| SRP007412_heart | 0 .00 RPM | 11 .74 RPM |
| SRP007412_kidney | 0 .03 RPM | 29 .40 RPM |
| SRP007412_liver | 0 .00 RPM | 9 .43 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2595 |
| Pan troglodytes | retro_ptro_1520 |
| Gorilla gorilla | retro_ggor_1624 |
| Callithrix jacchus | retro_cjac_656 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009377 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000031110 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007826 | 1 retrocopy | |
| Homo sapiens | ENSG00000106603 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000034928 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019023 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000018149 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003316 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017606 | 1 retrocopy |
retro_pabe_1914 ,
|
| Pan troglodytes | ENSPTRG00000019125 | 1 retrocopy |