RetrogeneDB ID: | retro_pabe_1864 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 21:45324691..45325119(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MYL6 | ||
| Ensembl ID: | ENSPPYG00000004647 | ||
| Aliases: | None | ||
| Description: | myosin light polypeptide 6 [Source:RefSeq peptide;Acc:NP_001126203] |
| Percent Identity: | 80.56 % |
| Parental protein coverage: | 94.7 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | TAEFKEAFQLFDRTGDGKIL-YSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTV |
| ..EFK.AF.LFD.TGDGK.L..S.CGD.MRALGQNPTNA..L.VLGNPKSDEMNVKVLDFEH.LP.LQTV | |
| Retrocopy | STEFKAAFRLFD*TGDGKVL<SSPCGDMMRALGQNPTNAAALEVLGNPKSDEMNVKVLDFEHSLPLLQTV |
| Parental | AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEELVRM |
| A.NKDQGTYEDYVE.L.VFDKE.NGTVMGAEIRHVLV.LGE.MTEE..EMLVAGHEDSNGCI....LVR. | |
| Retrocopy | AGNKDQGTYEDYVERLQVFDKEENGTVMGAEIRHVLVSLGEEMTEEGGEMLVAGHEDSNGCIDSKVLVRR |
| Parental | VLNG |
| VLNG | |
| Retrocopy | VLNG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 140 .94 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 193 .71 RPM |
| SRP007412_heart | 0 .00 RPM | 149 .37 RPM |
| SRP007412_kidney | 0 .00 RPM | 341 .88 RPM |
| SRP007412_liver | 0 .00 RPM | 295 .80 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2533 |
| Pan troglodytes | retro_ptro_1476 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Macropus eugenii | ENSMEUG00000001272 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000031838 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000090841 | 7 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000205 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017371 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000034596 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004646 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004647 | 3 retrocopies |
retro_pabe_1467, retro_pabe_1864 , retro_pabe_538,
|
| Sarcophilus harrisii | ENSSHAG00000004472 | 6 retrocopies | |
| Sus scrofa | ENSSSCG00000025467 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000023318 | 1 retrocopy |