RetrogeneDB ID: | retro_ptro_1476 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 21:29851201..29851629(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MYL6 | ||
| Ensembl ID: | ENSPTRG00000005080 | ||
| Aliases: | None | ||
| Description: | myosin, light chain 6, alkali, smooth muscle and non-muscle [Source:HGNC Symbol;Acc:7587] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 94.7 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | TAEFKEAFQLFDRTGDGKIL-YSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTV |
| ..EFK.AF.LFD.TGDGK.L..S.CGDVMRALGQNPTNA..L.VLGNPKSDEMNVKVLDFEHFLP.LQTV | |
| Retrocopy | STEFKAAFRLFD*TGDGKVL<SSPCGDVMRALGQNPTNATALEVLGNPKSDEMNVKVLDFEHFLPLLQTV |
| Parental | AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRH |
| A.N.DQGT.EDYVE.L.VFDKE.NGTVM..EI.HVLV.LGE.MTE...EMLVAGHEDS.GC...E..VR. | |
| Retrocopy | AGNRDQGT*EDYVERLQVFDKEENGTVMSTEIQHVLVSLGEEMTERGGEMLVAGHEDSSGCTDSEVLVRR |
| Parental | ILSG |
| .L.G | |
| Retrocopy | LLKG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 278 .04 RPM |
| SRP007412_cerebellum | 0 .14 RPM | 194 .80 RPM |
| SRP007412_heart | 0 .00 RPM | 205 .71 RPM |
| SRP007412_kidney | 0 .03 RPM | 841 .02 RPM |
| SRP007412_liver | 0 .00 RPM | 484 .63 RPM |
| SRP007412_testis | 0 .00 RPM | 116 .76 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2533 |
| Pongo abelii | retro_pabe_1864 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000092841 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000001272 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000031838 | 6 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000205 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017371 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000034596 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005080 | 2 retrocopies |
retro_ptro_1196, retro_ptro_1476 ,
|
| Pan troglodytes | ENSPTRG00000023043 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000004472 | 6 retrocopies | |
| Sus scrofa | ENSSSCG00000025467 | 1 retrocopy |