RetrogeneDB ID: | retro_pabe_1187 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 14:68632444..68632668(-) | ||
| Located in intron of: | ENSPPYG00000005927 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7A2 | ||
| Ensembl ID: | ENSPPYG00000016781 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIIa polypeptide 2 (liver) [Source:HGNC Symbol;Acc:2288] |
| Percent Identity: | 53.95 % |
| Parental protein coverage: | 65.22 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | VFSCGGCWSVTAKMLRNLLALRQIGQRTISTASRRHFKNKVPE-KQKLFQEDDEIPLYLKGGIADALLYR |
| ..SC.G.W.VT...........Q..QRT.S.AS.RHF.NK.PE.K.KLFQE...I...LKGG.AD.LLYR | |
| Retrocopy | LWSCQGSWAVTEPRCCRICWHCQVAQRTMSIASCRHFENKGPE<KRKLFQEKNGILVHLKGGRADDLLYR |
| Parental | ATMILA |
| ATM.L. | |
| Retrocopy | ATMVLS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 54 .63 RPM |
| SRP007412_cerebellum | 0 .61 RPM | 77 .82 RPM |
| SRP007412_heart | 0 .12 RPM | 51 .69 RPM |
| SRP007412_kidney | 0 .10 RPM | 72 .69 RPM |
| SRP007412_liver | 0 .12 RPM | 38 .22 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1434 |
| Gorilla gorilla | retro_ggor_1104 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014453 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000005096 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000010305 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000007404 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000015425 | 2 retrocopies | |
| Homo sapiens | ENSG00000112695 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005865 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000002313 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000015747 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004949 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016781 | 2 retrocopies |
retro_pabe_1187 , retro_pabe_2456,
|
| Pteropus vampyrus | ENSPVAG00000010401 | 6 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042903 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000004480 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002536 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000007294 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007874 | 1 retrocopy |