RetrogeneDB ID: | retro_cjac_1523 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 16:72983901..72984156(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000023209 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7A2 | ||
| Ensembl ID: | ENSCJAG00000010305 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.47 % |
| Parental protein coverage: | 73.91 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | AKMLRNLLALRQIGQRTISTTSRMHFKNRVAEKQKLFQEEDGIPVYLKGGIVDVILYRATMILTVGGAAY |
| AKMLRNLLALRQ.GQRT.STTS..HFKN...EKQ.LFQE.DGIPVY.KG...D..LYRATM.LTV.G.AY | |
| Retrocopy | AKMLRNLLALRQFGQRTVSTTSHRHFKNTGPEKQRLFQEDDGIPVYPKGRVADAPLYRATMTLTVRGTAY |
| Parental | AIYHLAVASFPKKQD |
| AIY.LA.ASFPKKQD | |
| Retrocopy | AIYQLAMASFPKKQD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 17 .86 RPM |
| SRP051959_heart | 0 .00 RPM | 8 .79 RPM |
| SRP051959_kidney | 0 .00 RPM | 19 .77 RPM |
| SRP051959_liver | 0 .00 RPM | 19 .75 RPM |
| SRP051959_lung | 0 .00 RPM | 7 .09 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 8 .01 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 7 .51 RPM |
| SRP051959_spleen | 0 .00 RPM | 9 .12 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014453 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000005096 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000010305 | 2 retrocopies |
retro_cjac_1523 , retro_cjac_4129,
|
| Callithrix jacchus | ENSCJAG00000014705 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000007404 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000015425 | 2 retrocopies | |
| Homo sapiens | ENSG00000112695 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005865 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000002313 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000015747 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004949 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016781 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000010401 | 6 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042903 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000004480 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002536 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000007294 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007874 | 1 retrocopy |