RetrogeneDB ID: | retro_ogar_2152 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873596.1:8325482..8325698(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOGAG00000016626 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.25 % |
| Parental protein coverage: | 93.9 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | YSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLVNLIRSVRTVMRVPLIIVNSVAI |
| .S..QAALLCV.A......E...K..G..T....G...E.P.IKSQ.VNLI.SVR...RVPL...NS.AI | |
| Retrocopy | HSCRQAALLCVKATEAIPQE---KSAGKQTVELVGS--EKPAIKSQPVNLIQSVRITTRVPLMTMNSIAI |
| Parental | VLLLLFG |
| .LLLLFG | |
| Retrocopy | ALLLLFG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000032961 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
| Homo sapiens | ENSG00000134049 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000090000 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy |
retro_ogar_2152 ,
|
| Pongo abelii | ENSPPYG00000009141 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |