RetrogeneDB ID: | retro_ocun_883 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 16:84397414..84397860(+) | ||
| Located in intron of: | ENSOCUG00000013453 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PPA1 | ||
| Ensembl ID: | ENSOCUG00000016001 | ||
| Aliases: | None | ||
| Description: | pyrophosphatase (inorganic) 1 [Source:HGNC Symbol;Acc:9226] |
| Percent Identity: | 63.58 % |
| Parental protein coverage: | 55.15 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | NYGA-IPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINV |
| NYG..IPQT...P.HNDKHTGC..DND..D.CE...KVCAR.........G.....DE.ETDW.V.A.NV | |
| Retrocopy | NYGP<IPQTRKGPRHNDKHTGCS*DNDRTDECETRRKVCARVKVRKGERCGHI-VTDEVETDWMVRAFNV |
| Parental | DDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKAFAVDIIKSTHDYWKALV |
| .DPD.ANYNDINDVKRLKP..LE...D.FR..K.PD.K.ENE.AF..EFKDK.FAV.IIKST.D.WKALV | |
| Retrocopy | HDPDEANYNDINDVKRLKPSDLEGPGDCFRGFKFPDRKTENELAFSVEFKDKDFAVKIIKSTYDHWKALV |
| Parental | TKKTDGKGISC |
| TKK.D.K.ISC | |
| Retrocopy | TKKMDRKAISC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 72 .46 RPM |
| SRP017611_kidney | 0 .00 RPM | 25 .24 RPM |
| SRP017611_liver | 0 .00 RPM | 22 .12 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000014023 | 1 retrocopy | |
| Homo sapiens | ENSG00000180817 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000004048 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000017790 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006397 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016098 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005941 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016001 | 2 retrocopies |
retro_ocun_1373, retro_ocun_883 ,
|
| Procavia capensis | ENSPCAG00000006788 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000029405 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000002585 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008947 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005511 | 1 retrocopy |