RetrogeneDB ID: | retro_nleu_1147 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397283.1:4079090..4079282(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ACBD7 | ||
| Ensembl ID: | ENSNLEG00000012353 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 72.73 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | DDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDAMSAYISKAKELIEK |
| D..E...L.GLYKQAI.GDINI..P.MLDLKGKAKWEAW.L.KGLS.EDA.S..ISKAKELIEK | |
| Retrocopy | DNKEPNKLDGLYKQAIIGDINIEYPRMLDLKGKAKWEAWTLQKGLSKEDATSVSISKAKELIEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000009249 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027337 | 1 retrocopy | |
| Homo sapiens | ENSG00000176244 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015777 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000010587 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010290 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000012353 | 2 retrocopies |
retro_nleu_1147 , retro_nleu_1720,
|
| Pongo abelii | ENSPPYG00000002111 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000041316 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000007153 | 1 retrocopy |