RetrogeneDB ID: | retro_ggor_625 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 11:3913382..3913604(+) | ||
| Located in intron of: | ENSGGOG00000014152 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ACBD7 | ||
| Ensembl ID: | ENSGGOG00000015777 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.92 % |
| Parental protein coverage: | 84.09 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | LQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDAM |
| LQADFD..AEDVRKLK.RPD...LK.LYGL.KQAI.GDIN..C.GMLDLKGKAK.EA.N...G.S....M | |
| Retrocopy | LQADFDSVAEDVRKLKTRPDEEGLKQLYGL*KQAITGDINTECSGMLDLKGKAK*EALNFQNGISKDNVM |
| Parental | SAYI |
| S.YI | |
| Retrocopy | SVYI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .19 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 5 .16 RPM |
| SRP007412_heart | 0 .03 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .41 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .29 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .04 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_530 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000009249 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027337 | 1 retrocopy | |
| Homo sapiens | ENSG00000176244 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010372 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015777 | 3 retrocopies |
retro_ggor_1152, retro_ggor_1257, retro_ggor_625 ,
|
| Macaca mulatta | ENSMMUG00000010587 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000012353 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002111 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000041316 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000007153 | 1 retrocopy |