RetrogeneDB ID: | retro_mmus_3584 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:20842214..20842474(-) | ||
| Located in intron of: | ENSMUSG00000001127 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000082393 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Hrsp12 | ||
| Ensembl ID: | ENSMUSG00000022323 | ||
| Aliases: | Hrsp12, HR12, HRP12 | ||
| Description: | heat-responsive protein 12 [Source:MGI Symbol;Acc:MGI:1095401] |
| Percent Identity: | 78.41 % |
| Parental protein coverage: | 64.44 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MSSIIRKVISTTKAPAAIGPYSQAVQVDR-TIYISGQVGLDPSSGQLVPGGVVEEAKQALKNLGEILKAA |
| .SS.IRKVISTTKAP..IG.YSQAV.VDR.TI..S.QVG.DPSSGQLVP.GV..EAK.A.KN.GEILKAA | |
| Retrocopy | ISSLIRKVISTTKAPVVIGAYSQAVLVDR<TICMSRQVGMDPSSGQLVPRGVIKEAKRAFKNVGEILKAA |
| Parental | GCDFNNVVKTTVLLADMN |
| GCDF.NVVKTTVLLAD.N | |
| Retrocopy | GCDFTNVVKTTVLLADIN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .05 RPM | 21 .24 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 42 .21 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .76 RPM |
| SRP007412_kidney | 0 .02 RPM | 526 .27 RPM |
| SRP007412_liver | 0 .03 RPM | 522 .66 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .14 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000030250 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001278 | 8 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015560 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000025138 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000014805 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001185 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000002078 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011825 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000006575 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000022323 | 1 retrocopy |
retro_mmus_3584 ,
|
| Ornithorhynchus anatinus | ENSOANG00000021532 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001465 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000011452 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000002602 | 10 retrocopies |