RetrogeneDB ID: | retro_eeur_256 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_225397:1667..2006(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HRSP12 | ||
| Ensembl ID: | ENSEEUG00000014805 | ||
| Aliases: | None | ||
| Description: | heat-responsive protein 12 [Source:HGNC Symbol;Acc:16897] |
| Percent Identity: | 61.06 % |
| Parental protein coverage: | 83.09 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QAVLVGKTVYVSGQVGMDPSSGQLVPGGVTAETKQXXXXXXXXXXXXXXXXXXXVKTTVLLADINDFNTV |
| QAVLVGKTVYV.GQVGMDPSSGQLVPGGVTAETKQ...................VKTTVLLADINDF.TV | |
| Retrocopy | QAVLVGKTVYVWGQVGMDPSSGQLVPGGVTAETKQALKNMGEILKAADCDFSNVVKTTVLLADINDFDTV |
| Parental | NEIYKQXXXXXXXXXXXXXXXXXXXGRRVEIGGIAIQGPFTSM |
| NEIYKQ...................G.RVE...IAIQGPFTSM | |
| Retrocopy | NEIYKQYFKDYFPARDASQVAALPKGSRVETESIAIQGPFTSM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 9 .83 RPM | 4 .51 RPM |
| SRP017611_kidney | 334 .57 RPM | 141 .78 RPM |
| SRP017611_liver | 270 .59 RPM | 122 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000030250 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001278 | 8 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015560 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000025138 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000014805 | 1 retrocopy |
retro_eeur_256 ,
|
| Gorilla gorilla | ENSGGOG00000001185 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000002078 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011825 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000006575 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000022323 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000021532 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001465 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000011452 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000002602 | 10 retrocopies |