RetrogeneDB ID: | retro_mmus_2770 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 6:100604682..100605117(+) | ||
| Located in intron of: | ENSMUSG00000035378 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000079224 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ube2v2 | ||
| Ensembl ID: | ENSMUSG00000022674 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2 variant 2 [Source:MGI Symbol;Acc:MGI:1917870] |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECG |
| MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECG | |
| Retrocopy | MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECG |
| Parental | SKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVILQELRRLMMSKENMKLPQPPEG |
| SKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVILQELRRLMMSKENMKLPQPPEG | |
| Retrocopy | SKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVILQELRRLMMSKENMKLPQPPEG |
| Parental | QTYNN |
| QTYNN | |
| Retrocopy | QTYNN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 23 .48 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 18 .80 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .89 RPM |
| SRP007412_kidney | 0 .00 RPM | 6 .70 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .24 RPM |
| SRP007412_testis | 0 .00 RPM | 3 .98 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_116872 | 89 libraries | 34 libraries | 478 libraries | 344 libraries | 127 libraries |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000032182 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000017749 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016581 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000010191 | 10 retrocopies | |
| Mus musculus | ENSMUSG00000022674 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000090213 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013382 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000006933 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000000293 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000001829 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000022190 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000008325 | 1 retrocopy |