RetrogeneDB ID: | retro_mmus_2458 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 4:48627883..48628117(-) | ||
| Located in intron of: | ENSMUSG00000028347 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Glipr2 | ||
| Ensembl ID: | ENSMUSG00000028480 | ||
| Aliases: | Glipr2, 5730414A08Rik, C77180, GAPR-1 | ||
| Description: | GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:MGI:1917770] |
| Percent Identity: | 60.26 % |
| Parental protein coverage: | 50.65 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 0 |
| Parental | HGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQTGKDVADRWYSEIKSYNFQ |
| H.V.PLKLC.KL..EA.Q..E..A.TRILKH.PESS.GQC.ENLA.A...Q..K.VADR...EIK....Q | |
| Retrocopy | HRVSPLKLCQKLS*EAEQDLEVPANTRILKHGPESSCGQCWENLA*APCTQARKEVADR*HREIKNDHSQ |
| Parental | QPGFTSGT |
| .PGF..GT | |
| Retrocopy | EPGF*DGT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 2 .45 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .91 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .39 RPM |
| SRP007412_kidney | 0 .00 RPM | 3 .33 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .01 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .88 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_2217 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000030686 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008950 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000012831 | 1 retrocopy | |
| Felis catus | ENSFCAG00000012762 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000017673 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011791 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000028480 | 1 retrocopy |
retro_mmus_2458 ,
|
| Rattus norvegicus | ENSRNOG00000014838 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000009276 | 2 retrocopies |