RetrogeneDB ID: | retro_mmus_2439 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 4:19993201..19993497(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Copz1 | ||
| Ensembl ID: | ENSMUSG00000060992 | ||
| Aliases: | Copz1, 5930435A22Rik, AA407760, D4Ertd360e | ||
| Description: | coatomer protein complex, subunit zeta 1 [Source:MGI Symbol;Acc:MGI:1929063] |
| Percent Identity: | 77.0 % |
| Parental protein coverage: | 55.93 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQ-KAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYF |
| SLYTVKA.LILDNDGD.LFAKYYDDTYP.VKEQ..AF..NI.NKTH..DSEI.LLEG..V.YKSSI.LYF | |
| Retrocopy | SLYTVKATLILDNDGDTLFAKYYDDTYPRVKEQ<RAFGMNICNKTHWMDSEITLLEGMPVIYKSSINLYF |
| Parental | YVIGSSYENELMLMAVLNCLFDSLSQMLRK |
| ..I...YE.ELMLMAVLNCLF.SLS.MLRK | |
| Retrocopy | CAIVCFYESELMLMAVLNCLFNSLSPMLRK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 60 .51 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 44 .33 RPM |
| SRP007412_heart | 0 .00 RPM | 39 .78 RPM |
| SRP007412_kidney | 0 .00 RPM | 77 .58 RPM |
| SRP007412_liver | 0 .05 RPM | 115 .27 RPM |
| SRP007412_testis | 0 .05 RPM | 35 .54 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_2209 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000005384 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000006536 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018887 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000013499 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000008401 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000060992 | 1 retrocopy |
retro_mmus_2439 ,
|
| Rattus norvegicus | ENSRNOG00000036835 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008730 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001654 | 2 retrocopies |