RetrogeneDB ID: | retro_mmus_2036 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 2:59564270..59564693(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000081157 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Mrps18b | ||
| Ensembl ID: | ENSMUSG00000024436 | ||
| Aliases: | Mrps18b, 2400002C15Rik | ||
| Description: | mitochondrial ribosomal protein S18B [Source:MGI Symbol;Acc:MGI:1914223] |
| Percent Identity: | 97.16 % |
| Parental protein coverage: | 87.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VAQNVKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARECGLLSYYVPQVEPRDADFGTVHGAVS |
| ...NVKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARECGLLSYYVPQVEPRDADF.TVHGAVS | |
| Retrocopy | IEKNVKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARECGLLSYYVPQVEPRDADFRTVHGAVS |
| Parental | VTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEESGPPPESMPEMPTTPPAESSIEQPGSQS |
| VTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEESGPPPESMPEMPTTPPAESSIEQPGSQS | |
| Retrocopy | VTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEESGPPPESMPEMPTTPPAESSIEQPGSQS |
| Parental | A |
| A | |
| Retrocopy | A |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 6 .38 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 4 .65 RPM |
| SRP007412_heart | 0 .09 RPM | 8 .09 RPM |
| SRP007412_kidney | 0 .06 RPM | 7 .89 RPM |
| SRP007412_liver | 0 .22 RPM | 8 .60 RPM |
| SRP007412_testis | 0 .32 RPM | 10 .93 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005581 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012457 | 10 retrocopies | |
| Macaca mulatta | ENSMMUG00000006525 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000015933 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024436 | 1 retrocopy |
retro_mmus_2036 ,
|
| Nomascus leucogenys | ENSNLEG00000005224 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000002149 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016412 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017932 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000804 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011853 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000003333 | 1 retrocopy |