RetrogeneDB ID: | retro_meug_712 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold16614:28744..29147(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS18B | ||
| Ensembl ID: | ENSMEUG00000012457 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein S18B [Source:HGNC Symbol;Acc:14516] |
| Percent Identity: | 54.68 % |
| Parental protein coverage: | 57.74 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | PRALCTRAPPEEESAIPVSLYQDA-PWEYLETEEYLARYGSRPVWADYRRNHKGGIPPQRTRKTCIRGNK |
| P..L....P.EEES....S.Y.DA.P.E.LE.EEY...YGS..VW..Y..NHKG.I..Q.....CI.GN. | |
| Retrocopy | PKVLGIKIPSEEESFTFPSSYHDA>P*E*LEIEEYMVEYGSYLVWTNY*CNHKGSISSQQILEKCICGNR |
| Parental | VAGNPCPICRDQKLHVDFRNVKLLEQFVCAHTGVIFHAPYTGVCMKQHKKLTAAILKARDHGLLSYHIP |
| .AGNP.P........VDFRN.K.L.QF.C.HTGV.F...Y.G.CMK..KKLT.AILKARDHG.L.YH.P | |
| Retrocopy | IAGNPFPTSQE----VDFRNAKVLKQFFCPHTGVNF*VLYKGICMKEIKKLTEAILKARDHGFLYYHVP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005581 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012457 | 10 retrocopies |
retro_meug_1183, retro_meug_2004, retro_meug_2124, retro_meug_215, retro_meug_610, retro_meug_648, retro_meug_696, retro_meug_712 , retro_meug_717, retro_meug_734,
|
| Macaca mulatta | ENSMMUG00000006525 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000015933 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024436 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005224 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000002149 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016412 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017932 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000804 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011853 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000003333 | 1 retrocopy |