RetrogeneDB ID: | retro_mmus_199 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 2:163087105..163087561(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000070708 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BC048502 | ||
| Ensembl ID: | ENSMUSG00000053508 | ||
| Aliases: | None | ||
| Description: | cDNA sequence BC048502 [Source:MGI Symbol;Acc:MGI:2652828] |
| Percent Identity: | 57.14 % |
| Parental protein coverage: | 85.71 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MELESIELCPYDPNHRIPASRLQYHLASCKKKNPKIAKKMANCKYNACHVVPIKRLKEHEANCINRTAVD |
| ME.ESIE.CPY.P.HRIP.SR.QYHLASC.KKNPK.AKKMA.CKYNACHVVPI..L.EHEA.C.NR..V. | |
| Retrocopy | MEPESIEICPYNPHHRIPLSRFQYHLASCRKKNPKKAKKMASCKYNACHVVPIRKLAEHEATCVNRSSVE |
| Parental | DE-PLNLQKITHPVFEENENFSSAGSQFPDPDVWNVDHAHHFPSFVLETFAPKKLVCESDSRD |
| .E..L.......P...............PD...WNVD.A...P.FVL..F.P.KLVCESD... | |
| Retrocopy | EEDTLGPLQVSLPQPQNQDTLQVRWLSNPD--IWNVDGANCHPMFVLKSFVPQKLVCESDIQE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .07 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .17 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 113 .52 RPM | 48 .21 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_82730 | 1057 libraries | 11 libraries | 1 library | 1 library | 2 libraries |
| TSS #2 | TSS_82731 | 1057 libraries | 9 libraries | 2 libraries | 1 library | 3 libraries |
| TSS #3 | TSS_82732 | 1058 libraries | 7 libraries | 1 library | 0 libraries | 6 libraries |

| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_1938 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000029590 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000000958 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000023851 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031316 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000005664 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000053508 | 1 retrocopy |
retro_mmus_199 ,
|
| Rattus norvegicus | ENSRNOG00000036830 | 1 retrocopy |