RetrogeneDB ID: | retro_mmus_188 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 11:120762888..120763212(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000078249 | |
| Aliases: | Hmga1-rs1, ENSMUSG00000041059, Hmgi-rs1 | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Hmga1 | ||
| Ensembl ID: | ENSMUSG00000046711 | ||
| Aliases: | Hmga1, AL023995, Hmga1a, Hmga1b, Hmgi, Hmgiy, Hmgy | ||
| Description: | high mobility group AT-hook 1 [Source:MGI Symbol;Acc:MGI:96160] |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA |
| MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA | |
| Retrocopy | MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA |
| Parental | KTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ |
| KTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ | |
| Retrocopy | KTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .05 RPM | 7 .80 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 7 .43 RPM |
| SRP007412_heart | 0 .09 RPM | 11 .30 RPM |
| SRP007412_kidney | 0 .10 RPM | 2 .89 RPM |
| SRP007412_liver | 0 .05 RPM | 2 .84 RPM |
| SRP007412_testis | 0 .05 RPM | 6 .63 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_11022 | 532 libraries | 361 libraries | 174 libraries | 4 libraries | 1 library |
| TSS #2 | TSS_11023 | 429 libraries | 370 libraries | 224 libraries | 28 libraries | 21 libraries |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001061 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000015226 | 2 retrocopies | |
| Homo sapiens | ENSG00000137309 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010085 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000019529 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000046711 | 1 retrocopy |
retro_mmus_188 ,
|
| Nomascus leucogenys | ENSNLEG00000008303 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000016076 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000029838 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000040884 | 6 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000014283 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000488 | 1 retrocopy |