RetrogeneDB ID: | retro_mmul_788 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 11:8818390..8818679(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C19orf40 | ||
| Ensembl ID: | ENSMMUG00000017939 | ||
| Aliases: | None | ||
| Description: | chromosome 19 open reading frame 40 [Source:HGNC Symbol;Acc:28467] |
| Percent Identity: | 73.2 % |
| Parental protein coverage: | 72.18 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | IVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCVLYVTEADLVAG-NGYRKRLVRVRNSGNLQG |
| IV..EK..G.QL.Q.MQ.KIKLIF.DGLT.DFYL..R...LYVTEADLVA..N.Y.KRL..VRNS.NLQG | |
| Retrocopy | IVVTEK*HGFQLVQGMQRKIKLIFQDGLTSDFYLFSRFFILYVTEADLVAR>NSYIKRLGQVRNSSNLQG |
| Parental | IVVVEKTRMSEQYFPALQKFTVLDLGM |
| .VVVEK..MSEQYFPA.QKFTVLDLGM | |
| Retrocopy | VVVVEKAHMSEQYFPAIQKFTVLDLGM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .08 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .32 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .18 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .12 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .16 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .39 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000000728 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000011965 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000014134 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000002716 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000006401 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013287 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017939 | 1 retrocopy |
retro_mmul_788 ,
|
| Procavia capensis | ENSPCAG00000009727 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000016372 | 1 retrocopy |