RetrogeneDB ID: | retro_mmul_2561 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | X:37534560..37534857(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | OOEP | ||
| Ensembl ID: | ENSMMUG00000000416 | ||
| Aliases: | None | ||
| Description: | oocyte expressed protein [Source:HGNC Symbol;Acc:21382] |
| Percent Identity: | 81.0 % |
| Parental protein coverage: | 74.07 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | WFPVQELGDPLVFYLEAWLADELFGPDRAMIPEMEWTSQALMTVDIVDSGNLVEITVFGRPSVQNRVKSM |
| WFPVQEL.DPLVFYLEAWLADE.FGPDRA.IPEMEW..QAL.TV.IVDSGNL.EITVFG.P.V.NRVK.M | |
| Retrocopy | WFPVQELRDPLVFYLEAWLADEIFGPDRAIIPEMEWMIQALLTVGIVDSGNLAEITVFGWPCV*NRVKRM |
| Parental | LLCLASFHREHRARAEKMKHLEKNLKAHAS |
| LLCL..FHREH.A..EKMKHLE.NLKA.AS | |
| Retrocopy | LLCLKWFHREHCA*TEKMKHLE-NLKACAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .73 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4807 |
| Pan troglodytes | retro_ptro_3197 |
| Gorilla gorilla | retro_ggor_2992 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000009962 | 1 retrocopy | |
| Homo sapiens | ENSG00000203907 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016832 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000012754 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000017174 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000000416 | 2 retrocopies |
retro_mmul_2561 , retro_mmul_519,
|
| Nomascus leucogenys | ENSNLEG00000001204 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000025904 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000029545 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000025957 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001487 | 2 retrocopies |