RetrogeneDB ID: | retro_mmul_2184 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 7:121468827..121469055(+) | ||
| Located in intron of: | ENSMMUG00000001084 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.1138 | ||
| Ensembl ID: | ENSMMUG00000020115 | ||
| Aliases: | None | ||
| Description: | heat shock factor-binding protein 1 [Source:RefSeq peptide;Acc:NP_001244973] |
| Percent Identity: | 86.84 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELEGENKI |
| MA.TDPKT.QDLTSVV.T.LQQ.QDKFQTMSDQIIGRIDDMSS.IDDLEKNI...MTQAGVEELEGENKI | |
| Retrocopy | MAKTDPKTLQDLTSVV*TPLQQTQDKFQTMSDQIIGRIDDMSSHIDDLEKNITNPMTQAGVEELEGENKI |
| Parental | PATQKS |
| PAT.KS | |
| Retrocopy | PATHKS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 16 .70 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 40 .38 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 16 .40 RPM |
| SRP007412_heart | 0 .00 RPM | 30 .03 RPM |
| SRP007412_kidney | 0 .00 RPM | 30 .16 RPM |
| SRP007412_liver | 0 .00 RPM | 20 .70 RPM |
| SRP007412_testis | 0 .08 RPM | 160 .01 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_920 |